PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G114500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 312aa    MW: 35354.5 Da    PI: 8.08
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G114500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-161461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+W++ Ed++l d++k +G g W+  +++ g++R++k+c++rw++yl
  Aqcoe7G114500.1.p 14 RGAWSAHEDKILTDYIKIHGQGKWRELPKRAGLKRCGKSCRLRWLNYL 61
                       89********************************************97 PP

2Myb_DNA-binding50.25.8e-1667111147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg+   +E+el+v+++k+lG++ W++Ia +++ gRt++++k++w++ 
  Aqcoe7G114500.1.p  67 RGNINRDEEELIVKLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111
                        5666789***************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.666961IPR017930Myb domain
SuperFamilySSF466893.48E-2711108IPR009057Homeodomain-like
SMARTSM007173.8E-131363IPR001005SANT/Myb domain
PfamPF002491.0E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-211568IPR009057Homeodomain-like
CDDcd001672.40E-91661No hitNo description
PROSITE profilePS5129423.34262116IPR017930Myb domain
SMARTSM007175.4E-1466114IPR001005SANT/Myb domain
PfamPF002491.4E-1368112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2269115IPR009057Homeodomain-like
CDDcd001672.06E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGRSPCCSKQ GMNRGAWSAH EDKILTDYIK IHGQGKWREL PKRAGLKRCG KSCRLRWLNY  60
LRPDIVRGNI NRDEEELIVK LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NLAKRVEGSS  120
ILTPAHKNTP NQSRKKKNMT EPSNEAGKSS KVESVQVIRT KAYRCTKVFL TPQSNHLNIK  180
SQGRTDAELY QEVKLNSDNG MHTCSSGEEE DYRPSFMDLN IGDFGLSDFL NSDFSQLSNF  240
HRETKLFGDN NNNGSSNDIS LSSDQTMLFH GGIMDDWREN DCIHRSEESS SDLHSLALAS  300
FLDTEEGWLG E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010273927.11e-101PREDICTED: myb-related protein Zm38-like
TrEMBLA0A061GMC61e-101A0A061GMC6_THECC; GHMYB10, putative
STRINGVIT_11s0016g01300.t017e-94(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.13e-61MYB family protein